PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g061350.1
Common NameMTR_140s0008, MTR_3g061350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family B3
Protein Properties Length: 285aa    MW: 32884.5 Da    PI: 8.838
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g061350.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.42.6e-1319971193
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
               B3 11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                     ++++r+ lp+kf+++hg     s  + ++ ++g  W+v+   +k  g+++++kGWk F +   L+ g  v+F+++g+s+f  v
  Medtr3g061350.1 19 TNLQRIQLPNKFTRKHGVG--LSNPVLIKLPDGTGWKVYW--KKINGEMWFEKGWKTFTENYSLEHGCLVMFEYKGTSKFDVV 97
                     4567899*********644..44457788889********..999999****************************9999544 PP

2B340.64.6e-13192282195
                      EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkl..iyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                      ff+vl++++ l+ ++l++p      ++   +++ t ++     rsW+vkl  +y++k +r  l++GW  F  + gLk+gD++vF+l+++++  +
  Medtr3g061350.1 192 FFTVLINPNDLEANQLSVPDLKG-VIE---NKD-TNVMLLIGKRSWNVKLlrCYEGKYNR-RLSAGWHLFLTESGLKSGDVCVFELINKKDLVF 279
                      8999*************998664.222...233.334445688*******4333444444.599**********************98788755 PP

                      EEE CS
               B3  93 vvk 95 
                      +v+
  Medtr3g061350.1 280 KVH 282
                      655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.0839102IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-1811102IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.39E-1811102IPR015300DNA-binding pseudobarrel domain
CDDcd100174.12E-121199No hitNo description
SMARTSM010192.3E-1212102IPR003340B3 DNA binding domain
PfamPF023628.3E-111997IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-15188283IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-13189284IPR015300DNA-binding pseudobarrel domain
CDDcd100171.48E-10192284No hitNo description
PROSITE profilePS5086312.111192284IPR003340B3 DNA binding domain
SMARTSM010190.0028192282IPR003340B3 DNA binding domain
PfamPF023623.9E-10192282IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MAREDSILPI LFFKIILQTN LQRIQLPNKF TRKHGVGLSN PVLIKLPDGT GWKVYWKKIN  60
GEMWFEKGWK TFTENYSLEH GCLVMFEYKG TSKFDVVILG QNAVEIDYDS SSDTNDENDN  120
VDHSDDDESV EILDEWLNRK KARQRSPFIS TRPHKKVRGD HEKTTKRTSS INWPKNARAQ  180
EVAQNFISCN PFFTVLINPN DLEANQLSVP DLKGVIENKD TNVMLLIGKR SWNVKLLRCY  240
EGKYNRRLSA GWHLFLTESG LKSGDVCVFE LINKKDLVFK VHVY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0095110.0CT009511.9 M.truncatula DNA sequence from clone MTH2-69I7 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600453.10.0plant-specific B3-DNA-binding domain protein
TrEMBLG8A2Z40.0G8A2Z4_MEDTR; Plant-specific B3-DNA-binding domain protein
STRINGGLYMA20G24268.18e-99(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-17B3 family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]